PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010098140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB_related
Protein Properties Length: 357aa    MW: 38469.7 Da    PI: 6.6763
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010098140.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.33.5e-13113157347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
   XP_010098140.1 113 PWTEEEHRLFLIGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY 157
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.4E-4222IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129420.917106162IPR017930Myb domain
SuperFamilySSF466897.4E-17108163IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-19109161IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.7E-11110156IPR009057Homeodomain-like
SMARTSM007175.5E-10110160IPR001005SANT/Myb domain
CDDcd001673.80E-9113158No hitNo description
PfamPF002498.8E-11113157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGSGSGGGGG GASGGGLKLF GVRLTDGSII KKSASMGSLS  60
AHYHSSSSAA DSPNPDSPSS DPHHDEPDGY LSDDPSHASC STNRRADRKK GVPWTEEEHR  120
LFLIGLQKLG KGDWRGIARN YVVSRTPTQV ASHAQKYFIR QSNATRRKRR SSLFDMVPDM  180
ATDTPPVPEE DLLPSFHERE SDNAKSLPSL NLSLQPECEP MEATQDATVG EANEPMNMIQ  240
SNGFPPMVHG FFPAYVPVPF PLWPPSAAAP LDEEKSAERP HHQVLKPIPI VANHINVDEL  300
VGMSQLSLGE GEIGHKEPSP LSLKWLGEPS RQSAFQTNAQ VSGSDLSEGK NSAIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010098140.10.0Transcription factor
TrEMBLW9R6M00.0W9R6M0_9R
STRINGGLYMA13G43120.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-101MYB_related family protein